PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do027950.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NAC
Protein Properties Length: 350aa    MW: 38159.9 Da    PI: 6.7093
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do027950.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.52.2e-5261331128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 lppGfrFhPtd+elv +yLk+kv++ k+el evi+ +d+yk+ePw+Lp k  + +++ ew+fF++rd+ky++g+r+nrat++gyWkatgkd+++ + +g
  Do027950.1   6 LPPGFRFHPTDDELVGYYLKRKVDNLKIEL-EVIPVIDLYKSEPWELPeKsFLPKRDLEWFFFCPRDRKYPNGSRTNRATATGYWKATGKDRRIAC-DG 102
                 79****************************.99**************95334445667**************************************.99 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  + gl+ktLvfy+grap ge+tdWvmheyrl
  Do027950.1 103 GVYGLRKTLVFYRGRAPGGERTDWVMHEYRL 133
                 99***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-603155IPR003441NAC domain
PROSITE profilePS5100557.016156IPR003441NAC domain
PfamPF023655.2E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MGTMTLPPGF RFHPTDDELV GYYLKRKVDN LKIELEVIPV IDLYKSEPWE LPEKSFLPKR  60
DLEWFFFCPR DRKYPNGSRT NRATATGYWK ATGKDRRIAC DGGVYGLRKT LVFYRGRAPG  120
GERTDWVMHE YRLCQDLAHG ACNFIGAYAL CRVIKRHETG LLQGEPATKA KGAAGARAQM  180
SKVSSSSSLV SSEQLSAFTP TNSSSPPPTL DIGRGMCTIA ESGSAFQSPL AYSGDVTATA  240
TAGLPSSPLP PPLFDPGSHS SPHGTFFVGD DFPNLNAGES RSHAALFGGD MGMSVAEHDS  300
FTYPTNAFSN GAEMWNTAVS PMLCRQASDG GVDDLAAFFF SFTEENRIVF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-52116012169NO APICAL MERISTEM PROTEIN
1ut4_B9e-52116012169NO APICAL MERISTEM PROTEIN
1ut7_A9e-52116012169NO APICAL MERISTEM PROTEIN
1ut7_B9e-52116012169NO APICAL MERISTEM PROTEIN
3swm_A1e-51116015172NAC domain-containing protein 19
3swm_B1e-51116015172NAC domain-containing protein 19
3swm_C1e-51116015172NAC domain-containing protein 19
3swm_D1e-51116015172NAC domain-containing protein 19
3swp_A1e-51116015172NAC domain-containing protein 19
3swp_B1e-51116015172NAC domain-containing protein 19
3swp_C1e-51116015172NAC domain-containing protein 19
3swp_D1e-51116015172NAC domain-containing protein 19
4dul_A9e-52116012169NAC domain-containing protein 19
4dul_B9e-52116012169NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF7954881e-152JF795488.1 Zea mays NAC transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002467457.11e-153hypothetical protein SORBIDRAFT_01g028450
TrEMBLC5WRD21e-153C5WRD2_SORBI; Putative uncharacterized protein Sb01g028450
STRINGSb01g028450.11e-153(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62093854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.16e-83NAC domain containing protein 71